PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G193800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 141aa    MW: 15534.6 Da    PI: 8.699
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G193800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.61.3e-133593563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +rk++NR++A+rsR+RK+ +++eL++ v++L a N a++  +  ++  +a++++e+
  Sevir.5G193800.1.p 35 RKRKRKESNRLSAQRSRARKQRQLDELTDQVAALRARNGAMAAAAYDIERRCAAVQAEN 93
                        6789*************************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.8E-113195IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.993396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-83375No hitNo description
SuperFamilySSF579591.31E-83580No hitNo description
PfamPF001701.0E-93592IPR004827Basic-leucine zipper domain
CDDcd147024.51E-123687No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MASPASVVSA VTMSPPTGSE APGCDPQLAA VTAERKRKRK ESNRLSAQRS RARKQRQLDE  60
LTDQVAALRA RNGAMAAAAY DIERRCAAVQ AENTLLQAMN LELGERLQSL TELIQWMEGA  120
MYHQPQPQPQ LLDANMYNYY *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13439RKRKRK
23440RKRKRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968894.17e-98PREDICTED: ocs element-binding factor 1-like
TrEMBLK3XN167e-98K3XN16_SETIT; Uncharacterized protein
STRINGSi003289m2e-97(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137572428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-09basic leucine-zipper 44